(data stored in ACNUC7421 zone)

EMBL: CP001402.PE223

CP001402.PE223       Location/Qualifiers
FT   CDS             190113..190529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40859"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB8"
FT                   /protein_id="ACR40859.1"
FT                   /translation="MKVRVGIEGITMDSAHYTLSSYADSQIHGHTYIINVEVEGEVNEK
FT                   SGFVVDFNLLKKMVREVIQEWDHKLIIPKVDLDKSRFEGPFRVDYKVIDAPFPTAEYIG
FT                   IEVAKDIYLKLNKKYRILLKIYEGKDSYAIIEYP"
     MKVRVGIEGI TMDSAHYTLS SYADSQIHGH TYIINVEVEG EVNEKSGFVV DFNLLKKMVR        60
     EVIQEWDHKL IIPKVDLDKS RFEGPFRVDY KVIDAPFPTA EYIGIEVAKD IYLKLNKKYR       120
     ILLKIYEGKD SYAIIEYP                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page