(data stored in ACNUC7421 zone)

EMBL: CP001402.PE224

CP001402.PE224       Location/Qualifiers
FT   CDS             complement(190549..190992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40860"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB9"
FT                   /protein_id="ACR40860.1"
FT                   /translation="MTISIPSMIRKEIDNITFVFSVIPPIITLKNADEDVKDFLLKLSK
FT                   SFRIDIACENRDKKLCYPAIFGGVFIFDHDVIIKRYEIYGYLCNGEEESVKNINQLFKQ
FT                   LEQGKEWCFRFDDNSILCFKNRKESKECRWIDNIGLRFLIFSS"
     MTISIPSMIR KEIDNITFVF SVIPPIITLK NADEDVKDFL LKLSKSFRID IACENRDKKL        60
     CYPAIFGGVF IFDHDVIIKR YEIYGYLCNG EEESVKNINQ LFKQLEQGKE WCFRFDDNSI       120
     LCFKNRKESK ECRWIDNIGL RFLIFSS                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page