(data stored in ACNUC7421 zone)

EMBL: CP001402.PE225

CP001402.PE225       Location/Qualifiers
FT   CDS             complement(190949..192448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0227"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40861"
FT                   /db_xref="GOA:C4KKC0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC0"
FT                   /protein_id="ACR40861.1"
FT                   /translation="MKVLVVTGTLAAPILSEVAKNIKDIKVEIKVLNYPVASLMSTKFI
FT                   AENLKQTKYDVDYILLPGMVYGDAKIVEEVTGVKTFKGTEEAWDLPRVIEALKNGVQLS
FT                   TTEPADKIIGKMDNIEEKLRKIEEEAKISFEINGVKITTYPPPFRIFLEIDNKQEFEKL
FT                   ERLRKNINVVVLGLPVGHYDLDEVKNKVKQLVDYGHVVGIDAESPRELKEGVRAGASFV
FT                   FNLNETNLEELEEIRREAAFVVAPFNTENRGEITVDLVRKAKQKGFDKLIADPVLSPPL
FT                   RGLVNSIIEYKYVREKLQDIPILMGILNVTELIDADSLGVNALLSAIAGELGISNLLIM
FT                   EKGKTKWSSWELSQATKMISIALKENRLPKDIGIDLLVLKDKRIFRENFSADVIVNEYI
FT                   EPEMDKSGFAKIFVSEDGFGVKWIGKNKVTIKGKNGLSIGRELIRRVKDISKEHAVYIG
FT                   YELAKAEIAYQLDKNYIQDKPLFKKIINDNFHTEHDKKRDR"
     MKVLVVTGTL AAPILSEVAK NIKDIKVEIK VLNYPVASLM STKFIAENLK QTKYDVDYIL        60
     LPGMVYGDAK IVEEVTGVKT FKGTEEAWDL PRVIEALKNG VQLSTTEPAD KIIGKMDNIE       120
     EKLRKIEEEA KISFEINGVK ITTYPPPFRI FLEIDNKQEF EKLERLRKNI NVVVLGLPVG       180
     HYDLDEVKNK VKQLVDYGHV VGIDAESPRE LKEGVRAGAS FVFNLNETNL EELEEIRREA       240
     AFVVAPFNTE NRGEITVDLV RKAKQKGFDK LIADPVLSPP LRGLVNSIIE YKYVREKLQD       300
     IPILMGILNV TELIDADSLG VNALLSAIAG ELGISNLLIM EKGKTKWSSW ELSQATKMIS       360
     IALKENRLPK DIGIDLLVLK DKRIFRENFS ADVIVNEYIE PEMDKSGFAK IFVSEDGFGV       420
     KWIGKNKVTI KGKNGLSIGR ELIRRVKDIS KEHAVYIGYE LAKAEIAYQL DKNYIQDKPL       480
     FKKIINDNFH TEHDKKRDR                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page