(data stored in ACNUC7421 zone)

EMBL: CP001402.PE232

CP001402.PE232       Location/Qualifiers
FT   CDS             complement(199527..201188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0234"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40868"
FT                   /db_xref="GOA:C4KKC7"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC7"
FT                   /protein_id="ACR40868.1"
FT                   /translation="MDIEDRIKEWEEKVYLSWVKKRGERKKEFKTFSGIHIKPVYTPLD
FT                   AKGNYMEKLGLPGEYPFTRGIYPNMYRGRIWTIRQYAGFGSAEETNLRFRKLLEAGQTG
FT                   LSMAFDLPTQLGLDPDHELAYTEVGVVGVSMFHWKEMDMVMSGIPLDKVSTSMTINATA
FT                   MELLSMLIATTESRDINKNVLDGTVQNDILKEYIARKNFIYPPSPSMRYAIDIIEYSAK
FT                   YLPKWHPISISGYHIREAGADAVLEVAFTLADGMEYVRKTMERGISVDEFAPHLSFFFA
FT                   AYSDIFEEVAKFRAARRMWAKIMKEMFNAKKLESMMLRFHTQTGGAELTAQQPEINIIR
FT                   TTLQALAAVLGGTQSLHVNSYDEALALPTEKAAKIAIRVQQIIANESGAADVVDPLGGS
FT                   YYIEWLTDEIEERAWKIIDQVEKMGGMIKAIENGYPQAQIAESAYRIQKRIEESDLGKV
FT                   GVNMYYEPEWIGTTEIFRVNPEVRERVISRLKKYKQERDGMKVRDSLNNLRKVAEKENE
FT                   NLFPYMIDAIRAGATVGETSGVLRDIWGEYKEPSIF"
     MDIEDRIKEW EEKVYLSWVK KRGERKKEFK TFSGIHIKPV YTPLDAKGNY MEKLGLPGEY        60
     PFTRGIYPNM YRGRIWTIRQ YAGFGSAEET NLRFRKLLEA GQTGLSMAFD LPTQLGLDPD       120
     HELAYTEVGV VGVSMFHWKE MDMVMSGIPL DKVSTSMTIN ATAMELLSML IATTESRDIN       180
     KNVLDGTVQN DILKEYIARK NFIYPPSPSM RYAIDIIEYS AKYLPKWHPI SISGYHIREA       240
     GADAVLEVAF TLADGMEYVR KTMERGISVD EFAPHLSFFF AAYSDIFEEV AKFRAARRMW       300
     AKIMKEMFNA KKLESMMLRF HTQTGGAELT AQQPEINIIR TTLQALAAVL GGTQSLHVNS       360
     YDEALALPTE KAAKIAIRVQ QIIANESGAA DVVDPLGGSY YIEWLTDEIE ERAWKIIDQV       420
     EKMGGMIKAI ENGYPQAQIA ESAYRIQKRI EESDLGKVGV NMYYEPEWIG TTEIFRVNPE       480
     VRERVISRLK KYKQERDGMK VRDSLNNLRK VAEKENENLF PYMIDAIRAG ATVGETSGVL       540
     RDIWGEYKEP SIF                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page