(data stored in ACNUC7421 zone)

EMBL: CP001402.PE234

CP001402.PE234       Location/Qualifiers
FT   CDS             201769..202299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0236"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40870"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC9"
FT                   /protein_id="ACR40870.1"
FT                   /translation="MPKREEKDIFDLMDEWIREMEEEFERIEREFMRGFKGKGEEVKQF
FT                   GPYVYGFRITVGPDGVPKIEEFGNVRKIRGKPMISEEREPLADVIEKGDEIKVVAEVPG
FT                   VNKEDIKVKVTNGGKKLVITAKSEERQYYKEIDLPAEVDEKSAKANFKNGVLEITLKKK
FT                   SPSSDSGVEIKVE"
     MPKREEKDIF DLMDEWIREM EEEFERIERE FMRGFKGKGE EVKQFGPYVY GFRITVGPDG        60
     VPKIEEFGNV RKIRGKPMIS EEREPLADVI EKGDEIKVVA EVPGVNKEDI KVKVTNGGKK       120
     LVITAKSEER QYYKEIDLPA EVDEKSAKAN FKNGVLEITL KKKSPSSDSG VEIKVE           176
//

If you have problems or comments...

PBIL Back to PBIL home page