(data stored in ACNUC7421 zone)

EMBL: CP001402.PE235

CP001402.PE235       Location/Qualifiers
FT   CDS             complement(202315..202833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0237"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40871"
FT                   /db_xref="GOA:C4KKD0"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD0"
FT                   /protein_id="ACR40871.1"
FT                   /translation="MSEGPKVIFEETLVCPVCKSKTFKAIDYLYDTPHAGKLILSNWYC
FT                   ENCGYRFRDVKPYEAREPRVIEMRIENENDLRTIIYRSAFAKITIPELGIEIEPAGMSQ
FT                   GYISTIEGVLEIILDKVGDFCDKECENRIRLAMEGKIKFTLVLEDELGLSFIKSEKATV
FT                   KPLILTNSD"
     MSEGPKVIFE ETLVCPVCKS KTFKAIDYLY DTPHAGKLIL SNWYCENCGY RFRDVKPYEA        60
     REPRVIEMRI ENENDLRTII YRSAFAKITI PELGIEIEPA GMSQGYISTI EGVLEIILDK       120
     VGDFCDKECE NRIRLAMEGK IKFTLVLEDE LGLSFIKSEK ATVKPLILTN SD               172
//

If you have problems or comments...

PBIL Back to PBIL home page