(data stored in ACNUC7421 zone)

EMBL: CP001402.PE240

CP001402.PE240       Location/Qualifiers
FT   CDS             complement(205853..206359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0242"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40876"
FT                   /db_xref="GOA:C4KKD5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD5"
FT                   /protein_id="ACR40876.1"
FT                   /translation="MKVFEKDQKVKVHLKVNGQNYEVETEPRRLLVHVLRELGFTGVHV
FT                   GCDTSNCGACTVIMDGKSVKSCTILAVEADGSEILTIEGLAKDGKLHPIQEAFWEKHGL
FT                   QCGYCTPGMIMEAYWLLKENPNPTEEEIREGISGNLCRCTGYQNIVEAVKLASQKLRME
FT                   IPKAH"
     MKVFEKDQKV KVHLKVNGQN YEVETEPRRL LVHVLRELGF TGVHVGCDTS NCGACTVIMD        60
     GKSVKSCTIL AVEADGSEIL TIEGLAKDGK LHPIQEAFWE KHGLQCGYCT PGMIMEAYWL       120
     LKENPNPTEE EIREGISGNL CRCTGYQNIV EAVKLASQKL RMEIPKAH                    168
//

If you have problems or comments...

PBIL Back to PBIL home page