(data stored in ACNUC7421 zone)

EMBL: CP001402.PE243

CP001402.PE243       Location/Qualifiers
FT   CDS             complement(208159..208746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40879"
FT                   /db_xref="GOA:C4KKD8"
FT                   /db_xref="InterPro:IPR009844"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD8"
FT                   /protein_id="ACR40879.1"
FT                   /translation="MDLVQIAKYIGFSLLIVSIILYVFVDPVDRLLSYQGPILSGALLG
FT                   WYVLISNTPRDKFIETEGEKIPIVSILIRKRAPLFMAIGSLLIIPWLMPQIYPMVLKIQ
FT                   WLFVLSFLSEFLGGFMIGYIVPSLKFTEKLLLFSLGFAGDTIYLLLLYLASGIFHVPSQ
FT                   LLLNSVIVLVYGIKFPEGVVFAVYIMKKIGGI"
     MDLVQIAKYI GFSLLIVSII LYVFVDPVDR LLSYQGPILS GALLGWYVLI SNTPRDKFIE        60
     TEGEKIPIVS ILIRKRAPLF MAIGSLLIIP WLMPQIYPMV LKIQWLFVLS FLSEFLGGFM       120
     IGYIVPSLKF TEKLLLFSLG FAGDTIYLLL LYLASGIFHV PSQLLLNSVI VLVYGIKFPE       180
     GVVFAVYIMK KIGGI                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page