(data stored in ACNUC7421 zone)

EMBL: CP001402.PE247

CP001402.PE247       Location/Qualifiers
FT   CDS             210965..211744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0249"
FT                   /product="protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40883"
FT                   /db_xref="GOA:C4KKE2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE2"
FT                   /protein_id="ACR40883.1"
FT                   /translation="MIKRLENQQDIWKRIEIVGDIVIIGIPFNKRSEDLIEIANEILLT
FT                   FPYIKSVWGRCRDVSGTYRLSTYVYLAGEKRSETIYKEHKCRYFLDFTKVFFSEKLSYE
FT                   HLRVARQVKRGEIIINMFAGFGPFSILSAVLGKPKVIYSIDANPYAYYYMMVNVELNRA
FT                   YEVLPMYGDAFKRVYDLEDADRIIAPLPELADKAYEVALQKVKKGGTIHLYTEVETNRG
FT                   EDPVGIAMNKYKGSYFGRIVRSVNPHKYHVVVDIKVT"
     MIKRLENQQD IWKRIEIVGD IVIIGIPFNK RSEDLIEIAN EILLTFPYIK SVWGRCRDVS        60
     GTYRLSTYVY LAGEKRSETI YKEHKCRYFL DFTKVFFSEK LSYEHLRVAR QVKRGEIIIN       120
     MFAGFGPFSI LSAVLGKPKV IYSIDANPYA YYYMMVNVEL NRAYEVLPMY GDAFKRVYDL       180
     EDADRIIAPL PELADKAYEV ALQKVKKGGT IHLYTEVETN RGEDPVGIAM NKYKGSYFGR       240
     IVRSVNPHKY HVVVDIKVT                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page