(data stored in ACNUC7421 zone)

EMBL: CP001402.PE248

CP001402.PE248       Location/Qualifiers
FT   CDS             212070..213347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0250"
FT                   /product="glutamine synthetase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40884"
FT                   /db_xref="GOA:C4KKE3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE3"
FT                   /protein_id="ACR40884.1"
FT                   /translation="MSKENIFDALKSGKIDYVRVEFVDILGNTKGRSLRRAEFENVINN
FT                   NKGVDYPESLALMDYKDRPIKSKYEDIIAIPDLNTFVAIPYLERTARVLSFLVQPEGLS
FT                   YPYCSRSILNKAIEKLKEAGYTLQVSFEPTFYLLNSSLNPADYSKAFSLEGLLEQQNFL
FT                   KLLIKYLEEIDIQVETINKHYGPGQYEVKLSQKSVLEAADSLISSREVIRDTAKMNNVI
FT                   ATFMPKPFKDYPSSSMDITLSLQTTDGKDIMYDSNDAKGIGLSKIAYNFISGILEHLPS
FT                   ILSIAAPTVNSYKRFKEVVTPNMPGIGTERHYIVRIPSYYKDTRQVEFRLADPLANPYI
FT                   LLASIIYAGLDGIERNLMVNINEYYGNLPQTLKESLSRLENDIYMKYNLGQDLITTYIN
FT                   IKNIEIEEYESEITEWEKEYYLKAGW"
     MSKENIFDAL KSGKIDYVRV EFVDILGNTK GRSLRRAEFE NVINNNKGVD YPESLALMDY        60
     KDRPIKSKYE DIIAIPDLNT FVAIPYLERT ARVLSFLVQP EGLSYPYCSR SILNKAIEKL       120
     KEAGYTLQVS FEPTFYLLNS SLNPADYSKA FSLEGLLEQQ NFLKLLIKYL EEIDIQVETI       180
     NKHYGPGQYE VKLSQKSVLE AADSLISSRE VIRDTAKMNN VIATFMPKPF KDYPSSSMDI       240
     TLSLQTTDGK DIMYDSNDAK GIGLSKIAYN FISGILEHLP SILSIAAPTV NSYKRFKEVV       300
     TPNMPGIGTE RHYIVRIPSY YKDTRQVEFR LADPLANPYI LLASIIYAGL DGIERNLMVN       360
     INEYYGNLPQ TLKESLSRLE NDIYMKYNLG QDLITTYINI KNIEIEEYES EITEWEKEYY       420
     LKAGW                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page