(data stored in ACNUC7421 zone)

EMBL: CP001402.PE249

CP001402.PE249       Location/Qualifiers
FT   CDS             213348..214334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0251"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40885"
FT                   /db_xref="GOA:C4KKE4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE4"
FT                   /protein_id="ACR40885.1"
FT                   /translation="MLAAILRSFGEELSLEDVREPSNGIILKVLATGLCHGDLHVMNGD
FT                   WKYEIKIELPKILGHEIVGEVVKGNHNFKEGDKVLVYNSVGCGKCKYCVSRKYQYCEKV
FT                   KIVGLNIDGGFAEYVSVPTDNILLRVDGNPVELAPLADAGITAYSSTKGIGEGDNVLII
FT                   GTGAVALLALQILKLKGARITVIGHNKNKLGKAKEIGADEVIDIQDGSTIASEIKESKF
FT                   DYIIDYVGSDYTLSDSMWLLNREGELRIVGEFGGTLTVPEQLLVLKGLKVRGILYGSFD
FT                   DLISVYKLYNEGKIRPIVNTYRLRDINKSIKGLREGKMIGRAVIVPP"
     MLAAILRSFG EELSLEDVRE PSNGIILKVL ATGLCHGDLH VMNGDWKYEI KIELPKILGH        60
     EIVGEVVKGN HNFKEGDKVL VYNSVGCGKC KYCVSRKYQY CEKVKIVGLN IDGGFAEYVS       120
     VPTDNILLRV DGNPVELAPL ADAGITAYSS TKGIGEGDNV LIIGTGAVAL LALQILKLKG       180
     ARITVIGHNK NKLGKAKEIG ADEVIDIQDG STIASEIKES KFDYIIDYVG SDYTLSDSMW       240
     LLNREGELRI VGEFGGTLTV PEQLLVLKGL KVRGILYGSF DDLISVYKLY NEGKIRPIVN       300
     TYRLRDINKS IKGLREGKMI GRAVIVPP                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page