(data stored in ACNUC7421 zone)

EMBL: CP001402.PE25

CP001402.PE25        Location/Qualifiers
FT   CDS             complement(22729..23460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0025"
FT                   /product="protein of unknown function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40661"
FT                   /db_xref="GOA:C4KJE1"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE1"
FT                   /protein_id="ACR40661.1"
FT                   /translation="MRISNTVYSVLLNPSNTEIYSFLTERIYRELVVIFATCKVNYKGR
FT                   AESVASESPRLIILKPDGTVIIHESVKREPLNWQPPGTKIEIMNDYPLKIVAQRKRPKE
FT                   VIEIDLKEVFYITSAEVKDGDFVIKGREIDIVNTIIQNPSMIEEGFVPLTREYNTPYGK
FT                   IDLVGLDKKGNFVIIEVKRSKAQLSAVSQLYRYYLHIRETKEDKVRGILVAPDLTTHAR
FT                   ELLQKLGLEFIRYDIQKYSSY"
     MRISNTVYSV LLNPSNTEIY SFLTERIYRE LVVIFATCKV NYKGRAESVA SESPRLIILK        60
     PDGTVIIHES VKREPLNWQP PGTKIEIMND YPLKIVAQRK RPKEVIEIDL KEVFYITSAE       120
     VKDGDFVIKG REIDIVNTII QNPSMIEEGF VPLTREYNTP YGKIDLVGLD KKGNFVIIEV       180
     KRSKAQLSAV SQLYRYYLHI RETKEDKVRG ILVAPDLTTH ARELLQKLGL EFIRYDIQKY       240
     SSY                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page