(data stored in ACNUC7421 zone)

EMBL: CP001402.PE252

CP001402.PE252       Location/Qualifiers
FT   CDS             215630..216073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40888"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE7"
FT                   /protein_id="ACR40888.1"
FT                   /translation="MKIKLKSLAKVVGEEELAVIPLAENEYFIECLNFYEDVEGGRQAR
FT                   LVVIVDKYGIIRQDQVNFIKGKKTFVDAIGIEDDFRKIQSVLKLDRIARMFKVPLYFDV
FT                   EIIEKPDVSKRGIKGFYNYLSVHKEIDMSKLKGLVSLSIEELV"
     MKIKLKSLAK VVGEEELAVI PLAENEYFIE CLNFYEDVEG GRQARLVVIV DKYGIIRQDQ        60
     VNFIKGKKTF VDAIGIEDDF RKIQSVLKLD RIARMFKVPL YFDVEIIEKP DVSKRGIKGF       120
     YNYLSVHKEI DMSKLKGLVS LSIEELV                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page