(data stored in ACNUC7421 zone)

EMBL: CP001402.PE254

CP001402.PE254       Location/Qualifiers
FT   CDS             complement(217105..217956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0256"
FT                   /product="PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40890"
FT                   /db_xref="GOA:C4KKS5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS5"
FT                   /protein_id="ACR40890.1"
FT                   /translation="MIHLAVGRFNIDIIVKLDSIPPIDSSHMTDVLEIMPGGAATNYAV
FT                   AVTKLGHSAKLLAKVGKSEVVRSLMEKVVELGVGLEYVEELNEKPSATLIFLRSDGTLS
FT                   MVRRLGASILLTREDVKRRFGLFDVIHFASVSPNVVVRDPYAKLVSYDPGPQAKNIESI
FT                   DVDILYINEKEYEMIEGKNIKARFIVIKMGKKGAKIITETEECSVEPIQVEKVVDTTGA
FT                   GDTFDAAFNVTYSEEKDIIKSLQVASVASGLKVTKIGGISSPTLEEVREYLRKKKPNVI
FT                   CK"
     MIHLAVGRFN IDIIVKLDSI PPIDSSHMTD VLEIMPGGAA TNYAVAVTKL GHSAKLLAKV        60
     GKSEVVRSLM EKVVELGVGL EYVEELNEKP SATLIFLRSD GTLSMVRRLG ASILLTREDV       120
     KRRFGLFDVI HFASVSPNVV VRDPYAKLVS YDPGPQAKNI ESIDVDILYI NEKEYEMIEG       180
     KNIKARFIVI KMGKKGAKII TETEECSVEP IQVEKVVDTT GAGDTFDAAF NVTYSEEKDI       240
     IKSLQVASVA SGLKVTKIGG ISSPTLEEVR EYLRKKKPNV ICK                         283
//

If you have problems or comments...

PBIL Back to PBIL home page