(data stored in ACNUC7421 zone)

EMBL: CP001402.PE255

CP001402.PE255       Location/Qualifiers
FT   CDS             218232..219590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0257"
FT                   /product="TIP49 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40891"
FT                   /db_xref="GOA:C4KKS6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS6"
FT                   /protein_id="ACR40891.1"
FT                   /translation="MSEIRELKKPIREKASIHSHIKGLGLDDNGKAKFIADGLVGQAEA
FT                   REAAGVVVQLIKQGKMSGKGILFVGPPGTGKTALAVAIARELGEDTPFTAINASEIYST
FT                   ELKKTEILTQLIRKSIGVRIREKRLVYEGVVKDRKIKVARSRLNPYSQAPVEAQITLTT
FT                   KDDERTLSVGEEIAQQLVSLGVKKGDVIMIDAQTGQVIVEGKAKGFEGAKTYDIETTKV
FT                   LEIPTGPVRKEKEITTTLTLNDLDLNLAARNLAVTAIFSFFTEREINEDVRKEVDRLVK
FT                   DWINQGRAELVVGVLFIDDAHTLDLEAFSFLTRALESELAPILILATNRGLTKIRGTDI
FT                   ESPHGIPLDLLDRLLIIPTRPYNADEIKEIIKIRADELEIELDPQALEELTKIGVENSL
FT                   RYSVQLLEPSLIIAQRNNRSIIKVEDVVVASKLFSDVKRSVKFVKEYENLLLK"
     MSEIRELKKP IREKASIHSH IKGLGLDDNG KAKFIADGLV GQAEAREAAG VVVQLIKQGK        60
     MSGKGILFVG PPGTGKTALA VAIARELGED TPFTAINASE IYSTELKKTE ILTQLIRKSI       120
     GVRIREKRLV YEGVVKDRKI KVARSRLNPY SQAPVEAQIT LTTKDDERTL SVGEEIAQQL       180
     VSLGVKKGDV IMIDAQTGQV IVEGKAKGFE GAKTYDIETT KVLEIPTGPV RKEKEITTTL       240
     TLNDLDLNLA ARNLAVTAIF SFFTEREINE DVRKEVDRLV KDWINQGRAE LVVGVLFIDD       300
     AHTLDLEAFS FLTRALESEL APILILATNR GLTKIRGTDI ESPHGIPLDL LDRLLIIPTR       360
     PYNADEIKEI IKIRADELEI ELDPQALEEL TKIGVENSLR YSVQLLEPSL IIAQRNNRSI       420
     IKVEDVVVAS KLFSDVKRSV KFVKEYENLL LK                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page