(data stored in ACNUC7421 zone)

EMBL: CP001402.PE256

CP001402.PE256       Location/Qualifiers
FT   CDS             219674..220240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0258"
FT                   /product="GMP synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40892"
FT                   /db_xref="GOA:C4KKS7"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS7"
FT                   /protein_id="ACR40892.1"
FT                   /translation="MKVGLVYYGGQYNHLILKNVKYLGADIEVTPPHKPVEELKKFDCV
FT                   IFSGGPYSVSEEIQKMGNSPLYIKELKVPMLGICLGHQLIAYVLGGVVRRALNPEYGLT
FT                   RINIFDEDTILKGFSQQLNVWESHNDEVVEPPSGFRVLASSANARVQAMANSSNSIFGV
FT                   QFHPEVKHTERGIEIFKNFLGVCRK"
     MKVGLVYYGG QYNHLILKNV KYLGADIEVT PPHKPVEELK KFDCVIFSGG PYSVSEEIQK        60
     MGNSPLYIKE LKVPMLGICL GHQLIAYVLG GVVRRALNPE YGLTRINIFD EDTILKGFSQ       120
     QLNVWESHND EVVEPPSGFR VLASSANARV QAMANSSNSI FGVQFHPEVK HTERGIEIFK       180
     NFLGVCRK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page