(data stored in ACNUC7421 zone)

EMBL: CP001402.PE257

CP001402.PE257       Location/Qualifiers
FT   CDS             complement(220243..221031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0259"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40893"
FT                   /db_xref="GOA:C4KKS8"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022443"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS8"
FT                   /protein_id="ACR40893.1"
FT                   /translation="MVSRLSTGILDFDKLIQGGIPQGFFIALTGEPGTGKTIFSLHFIA
FT                   KGLRDGDPCIYVTTEESRDSIIRQAKQFNWDFEEYIEKKLIIIDALMKEKEDQWSLVNL
FT                   TPEELVNKVIEAKQKLGYGKARLVIDSVSALFLDKPAMARKISYYLKRVLNKWNFTIYA
FT                   TSQYAITTSQAFGFGVEHVADGIIRFRRMIRNGELHRYILIEKMRQTDHDKHVWEIDIV
FT                   NGKGIVLKGRLEERREDYTLPEKVKRKIIESGKKTEEELK"
     MVSRLSTGIL DFDKLIQGGI PQGFFIALTG EPGTGKTIFS LHFIAKGLRD GDPCIYVTTE        60
     ESRDSIIRQA KQFNWDFEEY IEKKLIIIDA LMKEKEDQWS LVNLTPEELV NKVIEAKQKL       120
     GYGKARLVID SVSALFLDKP AMARKISYYL KRVLNKWNFT IYATSQYAIT TSQAFGFGVE       180
     HVADGIIRFR RMIRNGELHR YILIEKMRQT DHDKHVWEID IVNGKGIVLK GRLEERREDY       240
     TLPEKVKRKI IESGKKTEEE LK                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page