(data stored in ACNUC7421 zone)

EMBL: CP001402.PE258

CP001402.PE258       Location/Qualifiers
FT   CDS             221110..221595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0260"
FT                   /product="dual specificity protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40894"
FT                   /db_xref="GOA:C4KKS9"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS9"
FT                   /protein_id="ACR40894.1"
FT                   /translation="MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESW
FT                   GDKDYYLSILKKNGLQPLHIPIQDGGVPSDSQFLTIMRWLLSEKEGNLVHCVGGIGRTG
FT                   TILASYLILTEGLDVESAINEVRLVRPGAVQTYEQEMFLLRVEGMRKSWLKNIYSNS"
     MYWVRRKTIG GSGLPYTENE ILEWRKEGVK RVLVLPEDWE IEESWGDKDY YLSILKKNGL        60
     QPLHIPIQDG GVPSDSQFLT IMRWLLSEKE GNLVHCVGGI GRTGTILASY LILTEGLDVE       120
     SAINEVRLVR PGAVQTYEQE MFLLRVEGMR KSWLKNIYSN S                           161
//

If you have problems or comments...

PBIL Back to PBIL home page