(data stored in ACNUC7421 zone)

EMBL: CP001402.PE263

CP001402.PE263       Location/Qualifiers
FT   CDS             224496..225635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0265"
FT                   /product="protein of unknown function DUF763"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40899"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT4"
FT                   /protein_id="ACR40899.1"
FT                   /translation="MEVEGIADLPLHTGHVPPWLVPIMKRLAKAIVEIMILELGPQKVV
FT                   ERFSNPLWFQGFNNIIGMDWDSSGSTTVTLGILKDITNPKVHGFAVLGGKGKNALKVPD
FT                   EVDMLIFDVDKNKIKNISKIVAKVDSTLVQDGHQLYHHTMLVTEDGKWSIIQQGMNLET
FT                   KFARRYHWKETDNFVVEPHSAISGIKTNVVVNVIDRDKDRTRKLILDLLRENPNKIVSL
FT                   YTQAMAMLKGQSTLDMWIKGGSIAFVSKEARLIYMKPVDVNRIKQVLREMYESNPLTFE
FT                   EALINGLGPSTARALYLIADLIYNEPPSYKDPMNYPYDPFKYAFAIGGKDGIPYPVNRK
FT                   AAWEVIYTLEDFITRAKLEEGDKRLALRKLKELSKGIEK"
     MEVEGIADLP LHTGHVPPWL VPIMKRLAKA IVEIMILELG PQKVVERFSN PLWFQGFNNI        60
     IGMDWDSSGS TTVTLGILKD ITNPKVHGFA VLGGKGKNAL KVPDEVDMLI FDVDKNKIKN       120
     ISKIVAKVDS TLVQDGHQLY HHTMLVTEDG KWSIIQQGMN LETKFARRYH WKETDNFVVE       180
     PHSAISGIKT NVVVNVIDRD KDRTRKLILD LLRENPNKIV SLYTQAMAML KGQSTLDMWI       240
     KGGSIAFVSK EARLIYMKPV DVNRIKQVLR EMYESNPLTF EEALINGLGP STARALYLIA       300
     DLIYNEPPSY KDPMNYPYDP FKYAFAIGGK DGIPYPVNRK AAWEVIYTLE DFITRAKLEE       360
     GDKRLALRKL KELSKGIEK                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page