(data stored in ACNUC7421 zone)

EMBL: CP001402.PE269

CP001402.PE269       Location/Qualifiers
FT   CDS             complement(231620..232129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0271"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40905"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU0"
FT                   /protein_id="ACR40905.1"
FT                   /translation="MRLFRLYSELGDMYLVSYEQSNNSLDKIKIGDKNYEVKYLGPGNR
FT                   ENEYLFEINGKKYYVFIESDGTLIFNHQDFLRLDKVTEIPIKGEERVEEIIRGKEGEIV
FT                   SPLFGRVVKIRVKEGDAVNKGQPLLSIEAMKAETVISSPIGGIVQKILIKEGQGVKKGD
FT                   ILIVIK"
     MRLFRLYSEL GDMYLVSYEQ SNNSLDKIKI GDKNYEVKYL GPGNRENEYL FEINGKKYYV        60
     FIESDGTLIF NHQDFLRLDK VTEIPIKGEE RVEEIIRGKE GEIVSPLFGR VVKIRVKEGD       120
     AVNKGQPLLS IEAMKAETVI SSPIGGIVQK ILIKEGQGVK KGDILIVIK                   169
//

If you have problems or comments...

PBIL Back to PBIL home page