(data stored in ACNUC7421 zone)

EMBL: CP001402.PE27

CP001402.PE27        Location/Qualifiers
FT   CDS             24676..25239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40663"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE3"
FT                   /protein_id="ACR40663.1"
FT                   /translation="MQSTSVEIYLNIYSFRHELEHFTIEEERDEWSIVKDKANEKYIVK
FT                   EFADYGILIYPVYDLKDDILSSFSIQLPSVGKLKEILYTPEKWIDRLDLRINDNSIEVT
FT                   SLILDYLTGIDIINSLISSFGFQYAQLDDNSLIIKIRISRPLNRTLLDSHIRAIYHMLK
FT                   LYYSVKKAQEEIASKVTLSYIKSI"
     MQSTSVEIYL NIYSFRHELE HFTIEEERDE WSIVKDKANE KYIVKEFADY GILIYPVYDL        60
     KDDILSSFSI QLPSVGKLKE ILYTPEKWID RLDLRINDNS IEVTSLILDY LTGIDIINSL       120
     ISSFGFQYAQ LDDNSLIIKI RISRPLNRTL LDSHIRAIYH MLKLYYSVKK AQEEIASKVT       180
     LSYIKSI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page