(data stored in ACNUC7421 zone)

EMBL: CP001402.PE279

CP001402.PE279       Location/Qualifiers
FT   CDS             complement(242352..242639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40915"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV0"
FT                   /protein_id="ACR40915.1"
FT                   /translation="MAKKRSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKML
FT                   MDLEIIKQEGKQYMLTKKGEELLEDIRRFNDMRKNMDQLKEKINSVLSIK"
     MAKKRSKLEI IQAILEACKS GSPKTRIMYG ANLSYALTGR YIKMLMDLEI IKQEGKQYML        60
     TKKGEELLED IRRFNDMRKN MDQLKEKINS VLSIK                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page