(data stored in ACNUC7421 zone)

EMBL: CP001402.PE28

CP001402.PE28        Location/Qualifiers
FT   CDS             25264..26316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0028"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40664"
FT                   /db_xref="GOA:C4KJE4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE4"
FT                   /protein_id="ACR40664.1"
FT                   /translation="MLWLVMTTGKCNLKCDYCGGSFPANVVPYGVKYDINLLKRLVEND
FT                   KESTIIFYGGEPLLNYKFIMTVLDNVRAKRYGIQTNGIAVRLLPEKYWRKINVALLSID
FT                   GREETTDKHRGKGIYKAVLRSAKYLKDLGVETIARMAVTQDSDIFADVMHLIDLGLFDK
FT                   VHWQLDVIWSEEWDFKSWSFSYLHGIKRLTEYFLSELRKGRVVKIIPILGVISAHFFDG
FT                   YKGSPCGAGYSSVTVTPDGRILSCPIAVREKWAELGNVNLGYRLLEDPLPDDCKRCEFK
FT                   RYCGGRCLYAQKERYWGEEGFKVVDEVNKEYLRTVLSIIPEIEKLIRDGNIRLSDLYYN
FT                   PLLDSTEIIP"
     MLWLVMTTGK CNLKCDYCGG SFPANVVPYG VKYDINLLKR LVENDKESTI IFYGGEPLLN        60
     YKFIMTVLDN VRAKRYGIQT NGIAVRLLPE KYWRKINVAL LSIDGREETT DKHRGKGIYK       120
     AVLRSAKYLK DLGVETIARM AVTQDSDIFA DVMHLIDLGL FDKVHWQLDV IWSEEWDFKS       180
     WSFSYLHGIK RLTEYFLSEL RKGRVVKIIP ILGVISAHFF DGYKGSPCGA GYSSVTVTPD       240
     GRILSCPIAV REKWAELGNV NLGYRLLEDP LPDDCKRCEF KRYCGGRCLY AQKERYWGEE       300
     GFKVVDEVNK EYLRTVLSII PEIEKLIRDG NIRLSDLYYN PLLDSTEIIP                  350
//

If you have problems or comments...

PBIL Back to PBIL home page