(data stored in ACNUC7421 zone)

EMBL: CP001402.PE280

CP001402.PE280       Location/Qualifiers
FT   CDS             242787..243521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40916"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV1"
FT                   /protein_id="ACR40916.1"
FT                   /translation="MERIDIASVKGGVGKSFIAYFLSKALAASHKILLIDKDLTSTLSR
FT                   VYYIKGNLLSYLTVGQSSLAYFKEVDSGLTVVNVGCSRKIKNVEPKKIADIYSGFSDYD
FT                   LMIVDNPPIPSDVCLDTELQAYYTYLNEKRLDYNLILILPPNQLLLDESLAFMQLFKDY
FT                   IKNELSISLGSDLVNFDVISSVINMYNPRERIDVNKIKDLTSKIVKIPFKKEAIYTPFN
FT                   QLNMPMEISELAKYVLEYLESK"
     MERIDIASVK GGVGKSFIAY FLSKALAASH KILLIDKDLT STLSRVYYIK GNLLSYLTVG        60
     QSSLAYFKEV DSGLTVVNVG CSRKIKNVEP KKIADIYSGF SDYDLMIVDN PPIPSDVCLD       120
     TELQAYYTYL NEKRLDYNLI LILPPNQLLL DESLAFMQLF KDYIKNELSI SLGSDLVNFD       180
     VISSVINMYN PRERIDVNKI KDLTSKIVKI PFKKEAIYTP FNQLNMPMEI SELAKYVLEY       240
     LESK                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page