(data stored in ACNUC7421 zone)

EMBL: CP001402.PE283

CP001402.PE283       Location/Qualifiers
FT   CDS             245429..246172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0285"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40919"
FT                   /db_xref="GOA:C4KKV4"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV4"
FT                   /protein_id="ACR40919.1"
FT                   /translation="MIYEKVAEELISSSYAIAFTGAGISTASGIPDFRGPQGLWKKYSP
FT                   ELASIEYFEKDPKNFWGFYSLRMRGLFEAQPNKAHYSLAELEKMGIIKVIITQNIDGLH
FT                   QKAGSKNVIELHGTMRRSYCVLCLRTYDSLNVLSMIEKGNLPPRCDCGGIIRPDVVLFG
FT                   EPVKNIYEALSIAYESDLVISIGSSLTVYPANLIPQTVKERGGKLIILNMEETPLDSIA
FT                   DYVVREPVEISLPKIVENVRQKILS"
     MIYEKVAEEL ISSSYAIAFT GAGISTASGI PDFRGPQGLW KKYSPELASI EYFEKDPKNF        60
     WGFYSLRMRG LFEAQPNKAH YSLAELEKMG IIKVIITQNI DGLHQKAGSK NVIELHGTMR       120
     RSYCVLCLRT YDSLNVLSMI EKGNLPPRCD CGGIIRPDVV LFGEPVKNIY EALSIAYESD       180
     LVISIGSSLT VYPANLIPQT VKERGGKLII LNMEETPLDS IADYVVREPV EISLPKIVEN       240
     VRQKILS                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page