(data stored in ACNUC7421 zone)

EMBL: CP001402.PE284

CP001402.PE284       Location/Qualifiers
FT   CDS             246207..246407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40920"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV5"
FT                   /protein_id="ACR40920.1"
FT                   /translation="MIEEEEELKLIKQIFLIINENVPDDCRDLVINRLMNRLMDDIKEL
FT                   GVKETIKKWLGEEDEELIIVD"
     MIEEEEELKL IKQIFLIINE NVPDDCRDLV INRLMNRLMD DIKELGVKET IKKWLGEEDE        60
     ELIIVD                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page