(data stored in ACNUC7421 zone)

EMBL: CP001402.PE286

CP001402.PE286       Location/Qualifiers
FT   CDS             247415..247531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV7"
FT                   /protein_id="ACR40922.1"
FT                   /translation="MFPSTSPNDLRVIVYDPLGGVPVAELEVIKSKEKLRHG"
     MFPSTSPNDL RVIVYDPLGG VPVAELEVIK SKEKLRHG                                38
//

If you have problems or comments...

PBIL Back to PBIL home page