(data stored in ACNUC7421 zone)

EMBL: CP001402.PE287

CP001402.PE287       Location/Qualifiers
FT   CDS             complement(247637..248092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0289"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40923"
FT                   /db_xref="GOA:C4KKV8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKV8"
FT                   /protein_id="ACR40923.1"
FT                   /translation="MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEF
FT                   FHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAV
FT                   GMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE"
     MLVYGLYKSP LGYITVAKDD KGFIMLDFCD CVEGNSRDDS SFTEFFHKLD LYFEGKPINL        60
     REPINLKTYP FRLSVFKEVM KIPWGKVMTY KQIADSLGTS PRAVGMALSK NPILLIIPCH       120
     RVIAENGIGG YSRGVKLKRA LLELEGVKIP E                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page