(data stored in ACNUC7421 zone)

EMBL: CP001402.PE289

CP001402.PE289       Location/Qualifiers
FT   CDS             249819..250775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0291"
FT                   /product="Oligosaccharide biosynthesis protein Alg14 like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40925"
FT                   /db_xref="GOA:C4KKW0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW0"
FT                   /protein_id="ACR40925.1"
FT                   /translation="MTRILIIASGGGHTGFARAIAQYLPEKVDFVIPTNDPYSRQMISQ
FT                   YANKIYEIPKGREPDESSLVLFKRLFSIIAKSANIKKYDLIIATGSNHSIFPSFFQFLK
FT                   GGKVYGIESQDRLITKGKAIGIISNYAKGVFLHWQEQRKLYEKKGIVVGPIVEKPKYES
FT                   KDEGYILVTTGSMGFKRLFDAIVKSVIGKRIVIQTGKIDPTIYRNQNVTTFSFDPDLEK
FT                   WIANASLVITHQGKTAMEAVVMYRKPVIMVYNNDWKSATTLSDAKKYAEILGATFLSDP
FT                   ITWSDYNVLLEAIENANEPNVFDTGTPNLVKHVLSEL"
     MTRILIIASG GGHTGFARAI AQYLPEKVDF VIPTNDPYSR QMISQYANKI YEIPKGREPD        60
     ESSLVLFKRL FSIIAKSANI KKYDLIIATG SNHSIFPSFF QFLKGGKVYG IESQDRLITK       120
     GKAIGIISNY AKGVFLHWQE QRKLYEKKGI VVGPIVEKPK YESKDEGYIL VTTGSMGFKR       180
     LFDAIVKSVI GKRIVIQTGK IDPTIYRNQN VTTFSFDPDL EKWIANASLV ITHQGKTAME       240
     AVVMYRKPVI MVYNNDWKSA TTLSDAKKYA EILGATFLSD PITWSDYNVL LEAIENANEP       300
     NVFDTGTPNL VKHVLSEL                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page