(data stored in ACNUC7421 zone)

EMBL: CP001402.PE29

CP001402.PE29        Location/Qualifiers
FT   CDS             26342..27037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40665"
FT                   /db_xref="GOA:C4KJE5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE5"
FT                   /protein_id="ACR40665.1"
FT                   /translation="MSVKFEESSRLLETIKSMLASATSSILIVTYSIDQEAASEILTRA
FT                   ASGVNTVLVTADKDWARWLKNQSEAYKKDEEKRLYRELRRNESIYVQIIYFTSIISIAI
FT                   AIIDIILYFMMGSLIYYDVPLSLIAIGFLIYYGIRKRREALSQISILRESVQNFVQEVS
FT                   QIRDKIKEKLKIIEIDSQVSFSIVSCDDKTILFSAPLKFSMDKPSVHVVMEISKQLADQ
FT                   LVNLILKIS"
     MSVKFEESSR LLETIKSMLA SATSSILIVT YSIDQEAASE ILTRAASGVN TVLVTADKDW        60
     ARWLKNQSEA YKKDEEKRLY RELRRNESIY VQIIYFTSII SIAIAIIDII LYFMMGSLIY       120
     YDVPLSLIAI GFLIYYGIRK RREALSQISI LRESVQNFVQ EVSQIRDKIK EKLKIIEIDS       180
     QVSFSIVSCD DKTILFSAPL KFSMDKPSVH VVMEISKQLA DQLVNLILKI S                231
//

If you have problems or comments...

PBIL Back to PBIL home page