(data stored in ACNUC7421 zone)

EMBL: CP001402.PE290

CP001402.PE290       Location/Qualifiers
FT   CDS             250775..251458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0292"
FT                   /product="HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40926"
FT                   /db_xref="GOA:C4KKW1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW1"
FT                   /protein_id="ACR40926.1"
FT                   /translation="MVRKILDTLLEIFENNKSILKEKGWIVSSETSYEWWDGLKSAEEI
FT                   IISAILVQMSRWEIVKSKVEEMRSKGLTDFYKLYNTTEQELYDVLKGINFYKTKVKRLI
FT                   NLSKIIINLGSVEKFYDRNLLLSIDGIGEETADSILLFAGHKPNFPPSEYGKRVLSRVL
FT                   GISIKKKNEVKRLVEENLERNVYEYKLLHAGIVTVGRAFCFIENPKCEDCILKKVCKYY
FT                   RENSS"
     MVRKILDTLL EIFENNKSIL KEKGWIVSSE TSYEWWDGLK SAEEIIISAI LVQMSRWEIV        60
     KSKVEEMRSK GLTDFYKLYN TTEQELYDVL KGINFYKTKV KRLINLSKII INLGSVEKFY       120
     DRNLLLSIDG IGEETADSIL LFAGHKPNFP PSEYGKRVLS RVLGISIKKK NEVKRLVEEN       180
     LERNVYEYKL LHAGIVTVGR AFCFIENPKC EDCILKKVCK YYRENSS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page