(data stored in ACNUC7421 zone)

EMBL: CP001402.PE293

CP001402.PE293       Location/Qualifiers
FT   CDS             complement(253390..254439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40929"
FT                   /db_xref="GOA:C4KKW4"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW4"
FT                   /protein_id="ACR40929.1"
FT                   /translation="MKRYLILFLVLTSIIFIPITYSSNQFSFLNIGNTISYNIYETSSR
FT                   LGTYLTFNISMNLVWNGTVFVINGKSINKVFPAINTNNLTIENISGSYPYPLSVWINTA
FT                   AAGTPSGFLETGKEFTTYNGIPAVEFLDYNNYTYISLQYMIPLKSYYSINIDPASNLTY
FT                   SATATLTKGDLNFYTGPYNLYNVSFNYVYQNYTVNLFLLVASSNAEINLLNYSNHVAFN
FT                   ITGLKFISLLVPITTFHDLLGVSKFIYNGSPYIIILTSTGSMGSAYYYNTSVPIIGSYI
FT                   PGTNYYMISIPYSGNIVIIFGNYYSNYVNGSINIKNNGVGNGFSLLYALSAVIVVAVVI
FT                   TATYMLRKK"
     MKRYLILFLV LTSIIFIPIT YSSNQFSFLN IGNTISYNIY ETSSRLGTYL TFNISMNLVW        60
     NGTVFVINGK SINKVFPAIN TNNLTIENIS GSYPYPLSVW INTAAAGTPS GFLETGKEFT       120
     TYNGIPAVEF LDYNNYTYIS LQYMIPLKSY YSINIDPASN LTYSATATLT KGDLNFYTGP       180
     YNLYNVSFNY VYQNYTVNLF LLVASSNAEI NLLNYSNHVA FNITGLKFIS LLVPITTFHD       240
     LLGVSKFIYN GSPYIIILTS TGSMGSAYYY NTSVPIIGSY IPGTNYYMIS IPYSGNIVII       300
     FGNYYSNYVN GSINIKNNGV GNGFSLLYAL SAVIVVAVVI TATYMLRKK                   349
//

If you have problems or comments...

PBIL Back to PBIL home page