(data stored in ACNUC7421 zone)

EMBL: CP001402.PE294

CP001402.PE294       Location/Qualifiers
FT   CDS             254670..255032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40930"
FT                   /db_xref="GOA:C4KKW5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW5"
FT                   /protein_id="ACR40930.1"
FT                   /translation="MKKKAIGLSDDGYYVIFFISESEIGYKKTQINEMYYVSFIIVLLV
FT                   SILYVIFRYILVLTLFIIPILVYLFTIAISLHLYKPEIYEKITRVEIKDKIIKIHTSNK
FT                   TFIIHRGKILGFTDQI"
     MKKKAIGLSD DGYYVIFFIS ESEIGYKKTQ INEMYYVSFI IVLLVSILYV IFRYILVLTL        60
     FIIPILVYLF TIAISLHLYK PEIYEKITRV EIKDKIIKIH TSNKTFIIHR GKILGFTDQI       120
//

If you have problems or comments...

PBIL Back to PBIL home page