(data stored in ACNUC7421 zone)

EMBL: CP001402.PE299

CP001402.PE299       Location/Qualifiers
FT   CDS             258356..258799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40935"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX0"
FT                   /protein_id="ACR40935.1"
FT                   /translation="MIEWKGFGKRWGKCEECWLAYERRIQHENSLNCYKLGIPIDALKI
FT                   PLDQFLNIVKDVPGKYAIFGFPLNLLSKGVIIFYFDTKEEMENFIENIMNYIKSEISFR
FT                   EKKFYDIFVNTEWIGSMNWRRGCPEYDKKFGDWRGWRNHSKET"
     MIEWKGFGKR WGKCEECWLA YERRIQHENS LNCYKLGIPI DALKIPLDQF LNIVKDVPGK        60
     YAIFGFPLNL LSKGVIIFYF DTKEEMENFI ENIMNYIKSE ISFREKKFYD IFVNTEWIGS       120
     MNWRRGCPEY DKKFGDWRGW RNHSKET                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page