(data stored in ACNUC7421 zone)

EMBL: CP001402.PE300

CP001402.PE300       Location/Qualifiers
FT   CDS             258825..259556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40936"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX1"
FT                   /protein_id="ACR40936.1"
FT                   /translation="MNTSIDILLHYIFYIRMKAVRIFLTNLYQGKCLPKIDMSISIFVL
FT                   SLKGGIGKSRLSYELSRYISKRKFKKVLLIDNDSLSTLSNLLGHYGDGLLDGFDLRSSL
FT                   KEIDDIFILKLRNKVYFLDNFYDNERLKQLKFVLSRNWDYIIVDNYVGITETNPIIKIV
FT                   YEFSQLKIGIFLSDDLSLNSTTEYSNSWNYLDSKYVLLTNKPFDVHNIINRTIINAILN
FT                   QGEENYDEKFNIEKTNKINAS"
     MNTSIDILLH YIFYIRMKAV RIFLTNLYQG KCLPKIDMSI SIFVLSLKGG IGKSRLSYEL        60
     SRYISKRKFK KVLLIDNDSL STLSNLLGHY GDGLLDGFDL RSSLKEIDDI FILKLRNKVY       120
     FLDNFYDNER LKQLKFVLSR NWDYIIVDNY VGITETNPII KIVYEFSQLK IGIFLSDDLS       180
     LNSTTEYSNS WNYLDSKYVL LTNKPFDVHN IINRTIINAI LNQGEENYDE KFNIEKTNKI       240
     NAS                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page