(data stored in ACNUC7421 zone)

EMBL: CP001402.PE301

CP001402.PE301       Location/Qualifiers
FT   CDS             259671..260588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0303"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40937"
FT                   /db_xref="GOA:C4KKX2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX2"
FT                   /protein_id="ACR40937.1"
FT                   /translation="MPLDPRIKELLESGFVVPIGKASVDEVRKIFRQLASAAPKVEVGK
FT                   VEDIKIPGSEASINARVYLPKANGPYGVLIYLHGGGFVIGDVESYDPLCRAITNACNCV
FT                   VVSVDYRLAPEYKFPSAVIDSFDATNWVYNNLDKFDGKMGVAIAGDSAGGNLAAVVALL
FT                   SKGKLNLKYQILIYPAVGFDNVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRF
FT                   SPILVQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFP
FT                   LIEQGRDAIGLIGSVLRRAFYDKS"
     MPLDPRIKEL LESGFVVPIG KASVDEVRKI FRQLASAAPK VEVGKVEDIK IPGSEASINA        60
     RVYLPKANGP YGVLIYLHGG GFVIGDVESY DPLCRAITNA CNCVVVSVDY RLAPEYKFPS       120
     AVIDSFDATN WVYNNLDKFD GKMGVAIAGD SAGGNLAAVV ALLSKGKLNL KYQILIYPAV       180
     GFDNVSRSMI EYSDGFFLTR EHIEWFGSQY LRSPADLLDF RFSPILVQDL SGLPPALIIT       240
     AEYDPLRDQG EAYANRLLQA GVPVTSVRFN NVIHGFLSFF PLIEQGRDAI GLIGSVLRRA       300
     FYDKS                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page