(data stored in ACNUC7421 zone)

EMBL: CP001402.PE302

CP001402.PE302       Location/Qualifiers
FT   CDS             260665..261675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0304"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40938"
FT                   /db_xref="GOA:C4KKX3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX3"
FT                   /protein_id="ACR40938.1"
FT                   /translation="MKAVILPAHKQGYRIEEVPDPKPGKDEAIIKVNKAALCYRDLLQI
FT                   KGFYPRSKYPLILGHEVVGTVEEVGEDVNNFKKGDRVTSMLFVPDWSCEYCKSGEEVYC
FT                   KNRVVYAQELDGFFAEKAKVKASSLVKVPESVSDEGAVIVPCVAAMVYRGLKKAGIKKG
FT                   EIVLVTGASGGVGIHAIQVAKALGAKVIGVTSGESKAKIVSKYADYVIVGEKFSEEAKK
FT                   IGDVSIVIENVGPYTLEESMKSLRSGGKIIQIGNLDPSVTFNLRLGYIILKDISLMGHI
FT                   GANKNDIIKTLNLVKEGKIKPVIGSEVSLENFGKALDLLNDSKNRYGKILISNSF"
     MKAVILPAHK QGYRIEEVPD PKPGKDEAII KVNKAALCYR DLLQIKGFYP RSKYPLILGH        60
     EVVGTVEEVG EDVNNFKKGD RVTSMLFVPD WSCEYCKSGE EVYCKNRVVY AQELDGFFAE       120
     KAKVKASSLV KVPESVSDEG AVIVPCVAAM VYRGLKKAGI KKGEIVLVTG ASGGVGIHAI       180
     QVAKALGAKV IGVTSGESKA KIVSKYADYV IVGEKFSEEA KKIGDVSIVI ENVGPYTLEE       240
     SMKSLRSGGK IIQIGNLDPS VTFNLRLGYI ILKDISLMGH IGANKNDIIK TLNLVKEGKI       300
     KPVIGSEVSL ENFGKALDLL NDSKNRYGKI LISNSF                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page