(data stored in ACNUC7421 zone)

EMBL: CP001402.PE304

CP001402.PE304       Location/Qualifiers
FT   CDS             complement(262885..263784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0306"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40940"
FT                   /db_xref="GOA:C4KKX5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX5"
FT                   /protein_id="ACR40940.1"
FT                   /translation="MLLDLNFEISEDLKLILSSLNELLESRWSTKKLRAVMEGNKDYIE
FT                   EIWKEIIKLDILPYLSTLSLRDNVIINEVIGRKLLPGIVVSSIVASRGIKNKDILNRVY
FT                   AGEIRIAISDSNLVPSADEADYIIIGNRLIKRSNCTIRTFNSLDNSMKISKVDNIGNHE
FT                   DIEVNNAEIALSLASQIVGSGEEVVSMSIKYSKERVAFGKPIGSYQAIKHRVVNDAIDV
FT                   ELARSLILEAAENIKYAWIAKDLANKKIPKAILSGIQVHGGIGFTDDLDIHLHLRRALT
FT                   LSKLYNSKVNISEFLQPI"
     MLLDLNFEIS EDLKLILSSL NELLESRWST KKLRAVMEGN KDYIEEIWKE IIKLDILPYL        60
     STLSLRDNVI INEVIGRKLL PGIVVSSIVA SRGIKNKDIL NRVYAGEIRI AISDSNLVPS       120
     ADEADYIIIG NRLIKRSNCT IRTFNSLDNS MKISKVDNIG NHEDIEVNNA EIALSLASQI       180
     VGSGEEVVSM SIKYSKERVA FGKPIGSYQA IKHRVVNDAI DVELARSLIL EAAENIKYAW       240
     IAKDLANKKI PKAILSGIQV HGGIGFTDDL DIHLHLRRAL TLSKLYNSKV NISEFLQPI        299
//

If you have problems or comments...

PBIL Back to PBIL home page