(data stored in ACNUC7421 zone)

EMBL: CP001402.PE307

CP001402.PE307       Location/Qualifiers
FT   CDS             complement(265598..266644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0309"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40943"
FT                   /db_xref="GOA:C4KKX8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX8"
FT                   /protein_id="ACR40943.1"
FT                   /translation="MKAAVYKGYGLPLEIEEVPNPAPKEGEVLVKVASTGICHSDLHLL
FT                   SGELVGPLPNGFIIGHEIAGWVEKIGENVKNPYGLKEGDPVLVSWIVPCGICRYCANGK
FT                   ENYCKDNAKRLVGLIGINGGHAEYLTVPEIAVIPLAKNLDPYYSSPIACAYGTAYNALK
FT                   SANATSGKSVVIVGAGGVGSAAIQLANSIGLNPIVAVDIDENKLKSAKLLGATHIINAN
FT                   ENDARAKVLEALEDGADIVYETKPYPDFKLSLEVVKSGGTIVVTGLGGFSTLAQIPVTL
FT                   FVSRGITLVGSLGYRPRIDLPDLVSLASSGKIDIKKLVSHIYTPDRINEAYENLKKGLH
FT                   IRAIIRWN"
     MKAAVYKGYG LPLEIEEVPN PAPKEGEVLV KVASTGICHS DLHLLSGELV GPLPNGFIIG        60
     HEIAGWVEKI GENVKNPYGL KEGDPVLVSW IVPCGICRYC ANGKENYCKD NAKRLVGLIG       120
     INGGHAEYLT VPEIAVIPLA KNLDPYYSSP IACAYGTAYN ALKSANATSG KSVVIVGAGG       180
     VGSAAIQLAN SIGLNPIVAV DIDENKLKSA KLLGATHIIN ANENDARAKV LEALEDGADI       240
     VYETKPYPDF KLSLEVVKSG GTIVVTGLGG FSTLAQIPVT LFVSRGITLV GSLGYRPRID       300
     LPDLVSLASS GKIDIKKLVS HIYTPDRINE AYENLKKGLH IRAIIRWN                    348
//

If you have problems or comments...

PBIL Back to PBIL home page