(data stored in ACNUC7421 zone)

EMBL: CP001402.PE308

CP001402.PE308       Location/Qualifiers
FT   CDS             complement(266927..267331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40944"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX9"
FT                   /protein_id="ACR40944.1"
FT                   /translation="MEITFPTQHDIQALAKILSDPIFTLYKILGAETVSVKGNEFDALI
FT                   SLGVTSLILHGTVYVGNNKVSYKFYSVGTQKGEGGVLEFDLFKEGEIRLIVEFEGRFAS
FT                   FIKFSLRRKIEKNIKRLDEEVRLERIKRKI"
     MEITFPTQHD IQALAKILSD PIFTLYKILG AETVSVKGNE FDALISLGVT SLILHGTVYV        60
     GNNKVSYKFY SVGTQKGEGG VLEFDLFKEG EIRLIVEFEG RFASFIKFSL RRKIEKNIKR       120
     LDEEVRLERI KRKI                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page