(data stored in ACNUC7421 zone)

EMBL: CP001402.PE31

CP001402.PE31        Location/Qualifiers
FT   CDS             28274..28603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40667"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE7"
FT                   /protein_id="ACR40667.1"
FT                   /translation="MIERGTLVSLEEFKSNQKLKENVKNGIKGLVKLLFQEAGKIIKFT
FT                   SNDDLIFQLMKLGLISATLAQELLDILKIVNNLDSVDDEILHSMLVRIMEVIEEAINSI
FT                   DKYMG"
     MIERGTLVSL EEFKSNQKLK ENVKNGIKGL VKLLFQEAGK IIKFTSNDDL IFQLMKLGLI        60
     SATLAQELLD ILKIVNNLDS VDDEILHSML VRIMEVIEEA INSIDKYMG                   109
//

If you have problems or comments...

PBIL Back to PBIL home page