(data stored in ACNUC7421 zone)

EMBL: CP001402.PE313

CP001402.PE313       Location/Qualifiers
FT   CDS             complement(271910..272353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40949"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY4"
FT                   /protein_id="ACR40949.1"
FT                   /translation="MAEFVYPSKEWAEEWCKLLNESKEYNDAGKGWVSPILFVATDIPI
FT                   QVLDYLGVKGTNAIAMKLYLNNGKCQGTEFFSDITKADAPYVLEASYNSWKDIISGKLQ
FT                   VVSALLSGTIKLKKGSLFDLARYTTASVVMANISNKINTKFLV"
     MAEFVYPSKE WAEEWCKLLN ESKEYNDAGK GWVSPILFVA TDIPIQVLDY LGVKGTNAIA        60
     MKLYLNNGKC QGTEFFSDIT KADAPYVLEA SYNSWKDIIS GKLQVVSALL SGTIKLKKGS       120
     LFDLARYTTA SVVMANISNK INTKFLV                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page