(data stored in ACNUC7421 zone)

EMBL: CP001402.PE317

CP001402.PE317       Location/Qualifiers
FT   CDS             275701..276813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0318"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40953"
FT                   /db_xref="GOA:C4KKY8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY8"
FT                   /protein_id="ACR40953.1"
FT                   /translation="MSKNEDELEEYRSKIREWIRNNVPEEISSKGDMAPPEILREWQRR
FT                   IYEAGYLGVSWPKEYGGWGENPIKEIIVREEFAKAGVPYATVGLGVSVVGPAIILNGTE
FT                   EQKRKYIRRILTAEDIWCQGFSEPQAGSDLAGIKTKAEDKGDHFLVNGQKIWSSYAHLA
FT                   NYCLLLTRTGDVSERHKGLTMLIVDMKSEGIRVSPIKQITGRSEFNTLYFNNVKVPKEN
FT                   VVGKVGEGWKVAMSTLNYERLNIGTILFTVERLIRELSINNEELFNTAEDIVALKSFYK
FT                   RILERLKKGYVAGPEAAVIKLVASEAIQRVYENGVTNAGIEGLVMENGAGFRPEIIYGL
FT                   LASRAITIAGGTSEILRNLLGEVVLGLPKG"
     MSKNEDELEE YRSKIREWIR NNVPEEISSK GDMAPPEILR EWQRRIYEAG YLGVSWPKEY        60
     GGWGENPIKE IIVREEFAKA GVPYATVGLG VSVVGPAIIL NGTEEQKRKY IRRILTAEDI       120
     WCQGFSEPQA GSDLAGIKTK AEDKGDHFLV NGQKIWSSYA HLANYCLLLT RTGDVSERHK       180
     GLTMLIVDMK SEGIRVSPIK QITGRSEFNT LYFNNVKVPK ENVVGKVGEG WKVAMSTLNY       240
     ERLNIGTILF TVERLIRELS INNEELFNTA EDIVALKSFY KRILERLKKG YVAGPEAAVI       300
     KLVASEAIQR VYENGVTNAG IEGLVMENGA GFRPEIIYGL LASRAITIAG GTSEILRNLL       360
     GEVVLGLPKG                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page