(data stored in ACNUC7421 zone)

EMBL: CP001402.PE319

CP001402.PE319       Location/Qualifiers
FT   CDS             complement(278913..279845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0320"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40955"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ0"
FT                   /protein_id="ACR40955.1"
FT                   /translation="MTIFTLKLPMQGPLKYINTYLVKDNEEGILIDTGLPTQEDVITLT
FT                   NYLKAHGYPNLVVITHYHPDHMGLVRLFKDKSDILISDREFEYIAYLVSEEYEKEMRQY
FT                   LLANGFPEEFIQKMFKNRSRFNEIIDSVNFNTVKDGDVVKFGQGQMRVLLTPGHTMGHI
FT                   CLAYDKVVFCGDHILQDITPNVSLLRLEDNPLKAYLESLDRIERLSVEQLYPAHGEPFK
FT                   DVSKRVEEIKEHHKKRLEEIKNIISVLRRANGFDIASRISWYKKWDELSTFDKQLAMGE
FT                   TLAHIKYLVEEGVIREINNTNSIYYTMSS"
     MTIFTLKLPM QGPLKYINTY LVKDNEEGIL IDTGLPTQED VITLTNYLKA HGYPNLVVIT        60
     HYHPDHMGLV RLFKDKSDIL ISDREFEYIA YLVSEEYEKE MRQYLLANGF PEEFIQKMFK       120
     NRSRFNEIID SVNFNTVKDG DVVKFGQGQM RVLLTPGHTM GHICLAYDKV VFCGDHILQD       180
     ITPNVSLLRL EDNPLKAYLE SLDRIERLSV EQLYPAHGEP FKDVSKRVEE IKEHHKKRLE       240
     EIKNIISVLR RANGFDIASR ISWYKKWDEL STFDKQLAMG ETLAHIKYLV EEGVIREINN       300
     TNSIYYTMSS                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page