(data stored in ACNUC7421 zone)

EMBL: CP001402.PE324

CP001402.PE324       Location/Qualifiers
FT   CDS             284538..284693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40960"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ5"
FT                   /protein_id="ACR40960.1"
FT                   /translation="MGYAQKGESDYGDVSPVPLGSKESHDPPKRWLRAKYLHSIMNEHK
FT                   MIEMKV"
     MGYAQKGESD YGDVSPVPLG SKESHDPPKR WLRAKYLHSI MNEHKMIEMK V                 51
//

If you have problems or comments...

PBIL Back to PBIL home page