(data stored in ACNUC7421 zone)

EMBL: CP001402.PE325

CP001402.PE325       Location/Qualifiers
FT   CDS             complement(284763..285683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0329"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40961"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ6"
FT                   /protein_id="ACR40961.1"
FT                   /translation="MEVQYKFERISDNVYAFIQPNGDWFLSNTGVIIGKNYAIVVDSLT
FT                   NEKMTKQFISEIRKVTDKPIKYLINTHEHEDHLWTNHLFPNAITICHKNCREKVVEGMK
FT                   RGSNPYEKLFSTIDFSGYKYTPQEVVIDDEMRIFIDDDEVRIAYVGYAHTISDIYVYVP
FT                   NKKVVFTGDLLFSPPCTPFALMGYIQGYINTLENLANLNAEVYVAGHGEVSYDRKTLYE
FT                   SRDYLIFVRDEARKLMKNIDDPIRAAYEVNLGKYEEWISKERIIGNLARAYSELKGNPP
FT                   ASKLENIDKILIEMVKYREKKGGIK"
     MEVQYKFERI SDNVYAFIQP NGDWFLSNTG VIIGKNYAIV VDSLTNEKMT KQFISEIRKV        60
     TDKPIKYLIN THEHEDHLWT NHLFPNAITI CHKNCREKVV EGMKRGSNPY EKLFSTIDFS       120
     GYKYTPQEVV IDDEMRIFID DDEVRIAYVG YAHTISDIYV YVPNKKVVFT GDLLFSPPCT       180
     PFALMGYIQG YINTLENLAN LNAEVYVAGH GEVSYDRKTL YESRDYLIFV RDEARKLMKN       240
     IDDPIRAAYE VNLGKYEEWI SKERIIGNLA RAYSELKGNP PASKLENIDK ILIEMVKYRE       300
     KKGGIK                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page