(data stored in ACNUC7421 zone)

EMBL: CP001402.PE327

CP001402.PE327       Location/Qualifiers
FT   CDS             complement(286674..287603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0331"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40963"
FT                   /db_xref="GOA:C4KKZ8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ8"
FT                   /protein_id="ACR40963.1"
FT                   /translation="MPLDPQVKDLLTKINSLLPTTPLTPQEFRKVRNELFVNLFNKEKV
FT                   ELNDIRNMTISGSNGDIKIRLYFPSLKENLPAVVYYHGGGFVYGNLDTHDSVCRLISKL
FT                   SNTIVVSVDYRLAPEHKFPTQVYEAYDVVKWLANNGGKLSIDTSKIAVAGDSAGGNLSA
FT                   VVSILDRDNKDNIVKYQVLIYPVVNMLDSSPSIYNYGDGYFLTYERILWYNKQYVKDDN
FT                   DYYNPLASPVLANPHNLPPALVITAEYDPLRDQGEIYAHKLKMSGVKAISLRYNGMIHG
FT                   FVSFYEYLDVGREAIHHIASSIKKIFNY"
     MPLDPQVKDL LTKINSLLPT TPLTPQEFRK VRNELFVNLF NKEKVELNDI RNMTISGSNG        60
     DIKIRLYFPS LKENLPAVVY YHGGGFVYGN LDTHDSVCRL ISKLSNTIVV SVDYRLAPEH       120
     KFPTQVYEAY DVVKWLANNG GKLSIDTSKI AVAGDSAGGN LSAVVSILDR DNKDNIVKYQ       180
     VLIYPVVNML DSSPSIYNYG DGYFLTYERI LWYNKQYVKD DNDYYNPLAS PVLANPHNLP       240
     PALVITAEYD PLRDQGEIYA HKLKMSGVKA ISLRYNGMIH GFVSFYEYLD VGREAIHHIA       300
     SSIKKIFNY                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page