(data stored in ACNUC7421 zone)

EMBL: CP001402.PE330

CP001402.PE330       Location/Qualifiers
FT   CDS             complement(290400..290843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0334"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40966"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL01"
FT                   /protein_id="ACR40966.1"
FT                   /translation="MDFKGIFEVKKKINAVKEFLTNPKQFAECLPGLQSYEVMNNTFKA
FT                   NFKLDVSQMKIPHMSTLTALITANILEKETSVEINGNGRSAGVGIKFNIVMGLEEGEEI
FT                   TRVSWFARVDLGMLSKLLGEDNIRRIAEPNISHIINCISSKLS"
     MDFKGIFEVK KKINAVKEFL TNPKQFAECL PGLQSYEVMN NTFKANFKLD VSQMKIPHMS        60
     TLTALITANI LEKETSVEIN GNGRSAGVGI KFNIVMGLEE GEEITRVSWF ARVDLGMLSK       120
     LLGEDNIRRI AEPNISHIIN CISSKLS                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page