(data stored in ACNUC7421 zone)

EMBL: CP001402.PE332

CP001402.PE332       Location/Qualifiers
FT   CDS             292328..292924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0336"
FT                   /product="carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40968"
FT                   /db_xref="GOA:C4KL03"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL03"
FT                   /protein_id="ACR40968.1"
FT                   /translation="MPNSFILAIDEGTTSARAIIYNQDLEIVGIGQHEFPQHYPQPGYV
FT                   EHNPHEIWNSQMLAIKEAMEKAKIEGKQITGIGVTNQRETIILWDVKSGKPIYNAIVWQ
FT                   DRRTSHTTDWLKANYFRMIKDKMGLVPDPYFSASKIKWILDNVPNAREKAERGEIKFGT
FT                   VDTYLIWKLTNGKVHITDYSNASRIVLFNESYLFR"
     MPNSFILAID EGTTSARAII YNQDLEIVGI GQHEFPQHYP QPGYVEHNPH EIWNSQMLAI        60
     KEAMEKAKIE GKQITGIGVT NQRETIILWD VKSGKPIYNA IVWQDRRTSH TTDWLKANYF       120
     RMIKDKMGLV PDPYFSASKI KWILDNVPNA REKAERGEIK FGTVDTYLIW KLTNGKVHIT       180
     DYSNASRIVL FNESYLFR                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page