(data stored in ACNUC7421 zone)

EMBL: CP001402.PE333

CP001402.PE333       Location/Qualifiers
FT   CDS             complement(292895..293170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0337"
FT                   /product="sugar transport related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40969"
FT                   /db_xref="GOA:C4KL04"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL04"
FT                   /protein_id="ACR40969.1"
FT                   /translation="MVLLVGLGFMTLLLYLGGVYKVTGGILVPYFMLFVAFEQWAGAVT
FT                   LFYPTELYPTPVRAVGQGFATEISRVGSVLGVFYFPILTKQIGFIK"
     MVLLVGLGFM TLLLYLGGVY KVTGGILVPY FMLFVAFEQW AGAVTLFYPT ELYPTPVRAV        60
     GQGFATEISR VGSVLGVFYF PILTKQIGFI K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page